Artists

Artistsuche

Sortieren nach:

H

H.M.S. RMAHAACK, BRUCEHACKLERSHACKMANHACKMAN, MARIKAHADEN, PETRAHADITHAEMORRHAGEHAEMORRHAGE / DEPRESSIONHAEMORRHAGE | GRUESOME STUFF RELISHHAGGERTY, DANHAIGH, ROBERTHAIKU SALUTHAIL MARY MALLONHAINO, KEIJI & SUMACHAINT, HANKHAKER FLATEN, INGEBRIGTHALES CORNERHALF GIRLHALF JAPANESEHALF PINTHALF STRINGHALF-HANDED CLOUDHALFWAY TO GONEHALL OF THE MOUNTAIN KINGHALL, ERIKHALL, NATEHÄLLASHALMAHALMA / OUI MAIS NONHALO BENDERSHALO, LAURELHALPERN, NATHANHALSHUGHALSTEAD, NEILHAMAHAMANN, JUDITHHAMES, COCOHAMFERDHAMILTON STREETCARHAMILTON, GEORGEHAMILTON, LINDAHAMMERHEADHAMMILL, PETERHAMMOCKHANCOCK, HERBIEHANDHAND & LEGHAND OF KALLIACHHANDSOME FURSHANEMOONHANGEDUPHANGMENHANIN, ROGERHANK ROBOT & THE ETHNICSHANK WANGFORD AND THE LOST COWBOYSHANNELUNDERHANOI JANESHANS ANSELMHANS ANSELM QUINTETTHANS EHLERT HAMBURGHANTEHANTERHIRHANZHAPPY BIRTHDAYHAPPY RHODESHARA, MASUMIHARARIHARD SKINHARDEN, BOBBY & THE SOULFUL SAINTSHARK, TSUIHARLEM GOSPEL TRAVELERSHARLEM GOSPEL TRAVELERS FEATURING AARON FRAZER, THEHARLEM GOSPEL TRAVELERS, THEHARLON, JACK & THE DEAD CROWSHARMON, MARKHARMONIE FIELDSHARMONYHARNETTY, BRIANHARNIK, ELISABETH (ALL EARS AREA & STUDIO DAN ENSEMBLES)HARPER, BENHARRIS, BRADHARRIS, CALVINHARRIS, DAVE & THE POWERHOUSE FIVEHARRISON, RICHARD & BARON, BRUCEHARRISON, RICHARD & LASSANDER, DAGMARHARRISON, WENDELLHARROWEDHARSH SYMMETRYHART-LEMONNIER, YANHART, GRANTHART, OLIVERHARTING, KRISTIANHARTLE ROADHARVEY RUSHMORE & THE OCTOPUSHASHTRONAUTHASKINS, FUZZYHASLINGER, PAULHASSHASSELHOFF, DAVIDHASTEHATCHAM SOCIALHATCHETT, FRANKHATCHIEHATED, THEHATERHATFIELD, JULIANAHAU, CYNTHIA & WONG, ANTHONYHAUER, RUTGERHAUER, RUTGER & ROBERTS, ERICHAUJOBBHAUNTEDHAUNTED, THEHAUSCHILDT, STEVEHAUSE, DAVEHAUSER, DOMINIKHAUSER, WINGSHAUSUHAUTZINGER, FRANZHAVENER, THORSTENHAVERGALHAWK EYESHAWKS, THEHAWNAY TROOFHAYDEN, STERLINGHAYES, ISAACHAYES, ISAAC & FORSTER, ROBERTHAYLEY AND THE CRUSHERSHAYMAN, DARRENHAYSEED DIXIEHAZEMAZEHAZLEWOOD, LEEHE WHO CANNOT BE NAMED & PINK LINCOLNSHEAD ONHEAD, JOWEHEADCOATEES, THEEHEADEY, LENAHEADLESS CHICKENSHEADLESS NAMELESSHEADRESSHEADROOMHEADS.HEADSWIMHEALING POTPOURRIHEARD HEADEDHEART ATTACK ALLEYHEART OF THE GHOSTHEATHEATHERED PEARLSHEATSICKHEATWAVESHEAVEEHEAVENLYHEAVENLY BEATHEAVY HALOHEAVY METAL HORROR COLLECTIONHEAVY SEASHEAVY TEDDYSHEAVY TRAFFICHEAVY TRIPHEBDEN, KIERAN & TYLER, WILLIAMHECKER, FLORIAN & LECKEY, MARKHECKER, TIMHECKS, THEHECTOR COSTITA SEXTETOHEDVIG MOLLESTAD TRIOHEDVIG MOLLESTAD WEEJUNSHEELSHEESCH, ARNEHEFLIN, VAN & NADER, GEORGEHEFNERHEFTER, ROLANDHEHN, SASCHA [BLU-RAY & DVD]HEHN, SASCHA & BUCHFELLNER, USCHIHEIDECKER, TIMHEIDEMAN, KATHYHEIDEROOSJESHEIMATHEIMATGLÜCKHEINALIHEINZ, GERHARDHEISCHNEIDAHEIZMANN, PATRIC & KRÜGER, TIMOHEKT, LANDEHELADO NEGROHELD HOSTAGE FEAT: TIM RIPPER OWENSHELEN AND THE HORNSHELEN LOVEHELICONHELIO SEQUENCEHELIO SEQUENCE, THEHELIOSHELL, RENEHELL, RICHARD & THE VOIDOIDSHELL, THEHELLBASTARDHELLBILLY CLUBHELLSTOMPERSHELMHELMS ALEEHELSINKIHELVETIAHEMINGERS, THEHEMSWORTH, RYANHENGEHENNIX, CATHERINE CHRISTERHENRIKSEN, ARVEHENRIKSEN, LANCEHERBÄRDSHERDERHERE WE GO MAGICHERIDA PROFUNDAHERING, JONATHANHERLOP, MARINAHERMAN DUNEHERMANOS BALLUMBROSIO, LOSHERMETICSHERNANDO, JAVIERHERNDON, HOLLYHERODHEROES 2 NONEHEROIC DOSESHEROINE SHEIKS, THEHERON OBLIVIONHERRENSEXHERSELFHERSH, KRISTINHERTZAINAKHERTZOG, PAULHERZOG, PATRICKHESSLER, NICHESTON, CHARLTON & BENEDICT, DIRK
HEWITT, ELSAHEWLETT, DAVIDHEXDEBTHEXEREIHEY COLOSSUSHEY MERCEDESHEY RUINHEY SHOLAYHIBUSHIBIREHICKEY, CHARLIEHIDEHIEROGLYPHIC BEING & J.I. U AHN-SAM-BUHLHIGGS, PAULHIGH COMMANDHIGH PLACES / SOFT CIRCLEHIGH REEPERHIGH REEPER & HIPPIE DEATH CULTHIGH SOUTHHIGH STRUNG, THEHIGH VISHIGHLIFEHIGHLIGHT SEQUENCEHIGHTON, ALEXHIGHTOWER, WINSTONHIGUCHI, HISATOHIJSSHILDE MARIE HOLSENHILL, TERENCEHILLBILLY RAWHIDEHILLE, ANASTASIAHILLE, ANSTASIAHILLYARD, DAVE & THE ROCKSTEADY 7HILTON, CHARLIEHILTON, GEORGEHIMOYAHIMUKALTHINDS / LOS NASTYSHINT HINTHIP HOP MOGULS - DOCUMENTARYHIPBONE SLIM & THE CROWN-TOPPERSHIPBONE SLIM & THE KNEEJERKSHIPBONE SLIM & THE KNEETREMBLERSHIPBONE SLIM AND THE KNEE TREMBLERSHIPBONE SLIM AND THE KNEETREMBLERSHIPPIE DEATH CULTHIPPOTRAKTORHIROEHIRS COLLECTIVE, THEHIRSCH EFFEKT, THE | ZINNSCHAUERHIS ELECTRO BLUE VOICEHIS NAME IS ALIVEHISS GOLDEN MESSENGERHISS TRACTSHISTORICSHIT LA ROSAHIT PARADE, THEHITSHIVE DWELLERS, THEHOA QUEENHODOO RHYTHM DEVILSHOGAN, DOMINICHOLBERT, FREDHÖLDERLINHOLDRIDGE, LEEHOLKENBORG, TOM AKA JUNKIE XLHOLLAND, PATRICKHOLLEY, LONNIEHOLLOW & AKIMBOHOLLOW CRYHOLLOWSHOLLYWOOD AUTOPSYHOLLYWOOD STARSHOLMES, CHRIS (W.A.S.P.)HOLODRUMHOLOGRAMSHOLOPAWHOLY BALMHOLY FAMILY, THEHOLY GRAILHOLY HIVEHOLY MOTORSHOLY OTHERHOLY SCUMHOLY TERRORHOLY TUNICSHOLY WAVEHOLY, THEHOLYDRUG COUPLEHOLYDRUG COUPLE, THEHOMEHOME BOY AND THE C.O.L.HOME CURRENT, THE & PETER WIXHOME IS WHEREHOMELESS GOSPEL CHOIRHOMELESS GOSPEL CHOIR, THEHOMESHAKEHOMESICK, THEHOMLER, ANNA & MOSHIER, STEVEHONEY 2 HONEYHONEY CUTTHONEYMOON KILLERS, THEHONEYRIDERHONEYRUDEHONG, SHELLYHONSHU WOLVESHOODHOOD, ERNESTHOOKER, JOHN LEEHOOKERSHOOLIGAN (IR)HOOP, JESCAHOOPER, BRIAN HENRYHOP, ALE & ROBLES, LAURAHOPE, LARA & THE ARK-TONESHOPPER, DENNISHORHÖRBUCH - BADENBERG, SEBASTIANHORDHORFORSTAELSEHORN, JANAHORN, RICKHORNDALHORNS OF HAPPINESSHORRIFIC DEMISEHORROR CLASSICSHORROR CLASSICS - LIMITED EDITIONHORROR CLASSICS COLLECTIONHORROR CULT CLASSICSHORROR MY FRIENDHORRORPOPSHORS CONTROLE/HARD HEADEDHORSE JUMPER OF LOVEHORSE LORDSHORSEBURNERHORSEY FT. KING KRULEHORTEHORVITZ, WAYNEHOSONO, HARUOMIHOSPITAL JOBHOSPITALITYHOSTAL HANDSHAKEHOSTS, THEHOT CHIPHOT FLASH HEAT WAVEHOT HOT HEATHOT LUNCHHOT SNAKESHOT TUBS TIME MACHINEHOT WATER MUSICHOTEL BROOKSHOTOTOGISUHOUNDHOUNDSTOOTHHOUSE OF ALLHOUSE OF LOVE, THEHOUSES OF HEAVENHOUSTON JR, OTISHOUTON, EMMAHOW DO IHOW TO DRESS WELLHOWARD HELLOHOWARD, BARBARAHOWARD, JAMESHOWE, CATHERINEHOWE, STEVEHOWELL, PETER & JOHN FERDINANDOHOWLIN' MOONDOGGIESHOWLING GIANTHRSTAHTRKHU, KINGHU, SIBELLEHU, SIBELLE & YIP, AMYHUBBLE, ALICEHUBER, LAURINHUDSON MAKERHUDSON, ROCKHUES, MATTHIAS & SINGER, MARCHUGHES, BENJIHUGHES, WILLIAM ODELLHUI, SAMHUI, SAM & CHEUNG, MAGGIEHUINCAHULKOFFHUMAN EYEHUMAN FAILUREHUMAN FIGURESHUMAN ISSUEHUMANBEINGHUMAZAPASHUMBERT, JACQUELINE & DAVID ROSENBOOMHUMBERT, JACQUELINE & ROSENBOOM, DAVIDHUMBLE PIEHUMMINGBIRDHUNCHBACKHUNG, SAMMOHUNG, SAMMO & BIAO, YUENHUNNICUTT, JAMESHUNT, JERRYHUNT, THEHUNTER, CHARLIEHUNTER, V & WHINHA, HHUNTERCHILDHUNTERESSHUNTSMENHUNTSVILLEHUNXHUNX AND HIS PUNXHURLEY, DEANHURLEY, MICHAELHURRYHUSHDROPSHUSIK, LIDAHUSKYHUSTENHUSTER, FRANCISHUTCHHUWE, ANJAHVAL, JENNYHXXSHYACINTH & THE CENTRAL OFFICE OF INFORMATIONHYDHYDRA VEINHYDROMATICS, THEHYDROPLANEHYENA KILL, THEHYENASHYPERDONTIAHYPNO5EHYPNOTIC BRASS ENSEMBLEHYSTERESEHYVÖNEN, FRIDA
 

Special Feature

c/o pop 2024

Natürlich sind wir Ende April in Köln dabei. Lasst uns sehr gern Termine ausmachen! mehr

Tipp

Tipp

FU MANCHU

GO FOR IT...LIVE!
AT THE DOJO · LP · ID 163305
Newsletter
Join the Cargo Mailing List
» An- und Abmeldung